Protein Description: solute carrier family 6 (neurotransmitter transporter), member 4
Gene Name: SLC6A4
Alternative Gene Name: 5-HTT, HTT, OCD1, SERT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020838: 90%, ENSRNOG00000003476: 88%
Entrez Gene ID: 6532
Uniprot ID: P31645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A4
Alternative Gene Name: 5-HTT, HTT, OCD1, SERT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020838: 90%, ENSRNOG00000003476: 88%
Entrez Gene ID: 6532
Uniprot ID: P31645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI |
Documents & Links for Anti SLC6A4 pAb (ATL-HPA074728) | |
Datasheet | Anti SLC6A4 pAb (ATL-HPA074728) Datasheet (External Link) |
Vendor Page | Anti SLC6A4 pAb (ATL-HPA074728) at Atlas |
Documents & Links for Anti SLC6A4 pAb (ATL-HPA074728) | |
Datasheet | Anti SLC6A4 pAb (ATL-HPA074728) Datasheet (External Link) |
Vendor Page | Anti SLC6A4 pAb (ATL-HPA074728) |