Anti SLC6A4 pAb (ATL-HPA074728)

Catalog No:
ATL-HPA074728-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: solute carrier family 6 (neurotransmitter transporter), member 4
Gene Name: SLC6A4
Alternative Gene Name: 5-HTT, HTT, OCD1, SERT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020838: 90%, ENSRNOG00000003476: 88%
Entrez Gene ID: 6532
Uniprot ID: P31645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI

Documents & Links for Anti SLC6A4 pAb (ATL-HPA074728)
Datasheet Anti SLC6A4 pAb (ATL-HPA074728) Datasheet (External Link)
Vendor Page Anti SLC6A4 pAb (ATL-HPA074728) at Atlas

Documents & Links for Anti SLC6A4 pAb (ATL-HPA074728)
Datasheet Anti SLC6A4 pAb (ATL-HPA074728) Datasheet (External Link)
Vendor Page Anti SLC6A4 pAb (ATL-HPA074728)