Protein Description: solute carrier family 6 member 3
Gene Name: SLC6A3
Alternative Gene Name: DAT, DAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021609: 86%, ENSRNOG00000017302: 86%
Entrez Gene ID: 6531
Uniprot ID: Q01959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A3
Alternative Gene Name: DAT, DAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021609: 86%, ENSRNOG00000017302: 86%
Entrez Gene ID: 6531
Uniprot ID: Q01959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET |
| Documents & Links for Anti SLC6A3 pAb (ATL-HPA012763) | |
| Datasheet | Anti SLC6A3 pAb (ATL-HPA012763) Datasheet (External Link) |
| Vendor Page | Anti SLC6A3 pAb (ATL-HPA012763) at Atlas |
| Documents & Links for Anti SLC6A3 pAb (ATL-HPA012763) | |
| Datasheet | Anti SLC6A3 pAb (ATL-HPA012763) Datasheet (External Link) |
| Vendor Page | Anti SLC6A3 pAb (ATL-HPA012763) |