Protein Description: solute carrier family 6 member 2
Gene Name: SLC6A2
Alternative Gene Name: NAT1, NET, NET1, SLC6A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055368: 85%, ENSRNOG00000032776: 32%
Entrez Gene ID: 6530
Uniprot ID: P23975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A2
Alternative Gene Name: NAT1, NET, NET1, SLC6A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055368: 85%, ENSRNOG00000032776: 32%
Entrez Gene ID: 6530
Uniprot ID: P23975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA |
| Documents & Links for Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) | |
| Datasheet | Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) | |
| Datasheet | Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation) |