Protein Description: solute carrier family 6 (neutral amino acid transporter), member 17
Gene Name: SLC6A17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027894: 95%, ENSRNOG00000050090: 97%
Entrez Gene ID: 388662
Uniprot ID: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027894: 95%, ENSRNOG00000050090: 97%
Entrez Gene ID: 388662
Uniprot ID: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSV |
Gene Sequence | MNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSV |
Gene ID - Mouse | ENSMUSG00000027894 |
Gene ID - Rat | ENSRNOG00000050090 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) | |
Datasheet | Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) at Atlas |
Documents & Links for Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) | |
Datasheet | Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC6A17 pAb (ATL-HPA008044 w/enhanced validation) |