Anti SLC6A17 pAb (ATL-HPA008043)

Catalog No:
ATL-HPA008043-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: solute carrier family 6 member 17
Gene Name: SLC6A17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027894: 97%, ENSRNOG00000050090: 97%
Entrez Gene ID: 388662
Uniprot ID: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Gene Sequence RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Gene ID - Mouse ENSMUSG00000027894
Gene ID - Rat ENSRNOG00000050090
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SLC6A17 pAb (ATL-HPA008043)
Datasheet Anti SLC6A17 pAb (ATL-HPA008043) Datasheet (External Link)
Vendor Page Anti SLC6A17 pAb (ATL-HPA008043) at Atlas

Documents & Links for Anti SLC6A17 pAb (ATL-HPA008043)
Datasheet Anti SLC6A17 pAb (ATL-HPA008043) Datasheet (External Link)
Vendor Page Anti SLC6A17 pAb (ATL-HPA008043)