Protein Description: solute carrier family 6 member 17
Gene Name: SLC6A17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027894: 97%, ENSRNOG00000050090: 97%
Entrez Gene ID: 388662
Uniprot ID: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027894: 97%, ENSRNOG00000050090: 97%
Entrez Gene ID: 388662
Uniprot ID: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL |
| Documents & Links for Anti SLC6A17 pAb (ATL-HPA008043) | |
| Datasheet | Anti SLC6A17 pAb (ATL-HPA008043) Datasheet (External Link) |
| Vendor Page | Anti SLC6A17 pAb (ATL-HPA008043) at Atlas |
| Documents & Links for Anti SLC6A17 pAb (ATL-HPA008043) | |
| Datasheet | Anti SLC6A17 pAb (ATL-HPA008043) Datasheet (External Link) |
| Vendor Page | Anti SLC6A17 pAb (ATL-HPA008043) |