Description
Product Description
Protein Description: solute carrier family 6, member 16
Gene Name: SLC6A16
Alternative Gene Name: NTT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094152: 66%, ENSRNOG00000025220: 66%
Entrez Gene ID: 28968
Uniprot ID: Q9GZN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC6A16
Alternative Gene Name: NTT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094152: 66%, ENSRNOG00000025220: 66%
Entrez Gene ID: 28968
Uniprot ID: Q9GZN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP |
Gene Sequence | SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP |
Gene ID - Mouse | ENSMUSG00000094152 |
Gene ID - Rat | ENSRNOG00000025220 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812) | |
Datasheet | Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link) |
Vendor Page | Anti SLC6A16 pAb (ATL-HPA076812) at Atlas Antibodies |
Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812) | |
Datasheet | Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link) |
Vendor Page | Anti SLC6A16 pAb (ATL-HPA076812) |