Anti SLC6A16 pAb (ATL-HPA076812)

Catalog No:
ATL-HPA076812-25
$447.00

Description

Product Description

Protein Description: solute carrier family 6, member 16
Gene Name: SLC6A16
Alternative Gene Name: NTT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094152: 66%, ENSRNOG00000025220: 66%
Entrez Gene ID: 28968
Uniprot ID: Q9GZN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
Gene Sequence SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
Gene ID - Mouse ENSMUSG00000094152
Gene ID - Rat ENSRNOG00000025220
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812)
Datasheet Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link)
Vendor Page Anti SLC6A16 pAb (ATL-HPA076812) at Atlas Antibodies

Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812)
Datasheet Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link)
Vendor Page Anti SLC6A16 pAb (ATL-HPA076812)

Product Description

Protein Description: solute carrier family 6, member 16
Gene Name: SLC6A16
Alternative Gene Name: NTT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094152: 66%, ENSRNOG00000025220: 66%
Entrez Gene ID: 28968
Uniprot ID: Q9GZN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
Gene Sequence SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
Gene ID - Mouse ENSMUSG00000094152
Gene ID - Rat ENSRNOG00000025220
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812)
Datasheet Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link)
Vendor Page Anti SLC6A16 pAb (ATL-HPA076812) at Atlas Antibodies

Documents & Links for Anti SLC6A16 pAb (ATL-HPA076812)
Datasheet Anti SLC6A16 pAb (ATL-HPA076812) Datasheet (External Link)
Vendor Page Anti SLC6A16 pAb (ATL-HPA076812)