Protein Description: solute carrier family 4 member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH |
| Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) | |
| Datasheet | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) | |
| Datasheet | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) |