Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)

Catalog No:
ATL-HPA076725-25
$447.00

Description

Product Description

Protein Description: solute carrier family 4 member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
Gene Sequence FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
Gene ID - Mouse ENSMUSG00000026904
Gene ID - Rat ENSRNOG00000005307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)
Datasheet Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)

Product Description

Protein Description: solute carrier family 4 member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
Gene Sequence FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
Gene ID - Mouse ENSMUSG00000026904
Gene ID - Rat ENSRNOG00000005307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)
Datasheet Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)