Description
Product Description
Protein Description: solute carrier family 4 member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH |
Gene Sequence | FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH |
Gene ID - Mouse | ENSMUSG00000026904 |
Gene ID - Rat | ENSRNOG00000005307 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) | |
Datasheet | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) | |
Datasheet | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation) |