Protein Description: solute carrier family 45, member 4
Gene Name: SLC45A4
Alternative Gene Name: KIAA1126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079020: 55%, ENSRNOG00000007818: 54%
Entrez Gene ID: 57210
Uniprot ID: Q5BKX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC45A4
Alternative Gene Name: KIAA1126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079020: 55%, ENSRNOG00000007818: 54%
Entrez Gene ID: 57210
Uniprot ID: Q5BKX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETERLQVLTSVRSRHIGWCR |
Documents & Links for Anti SLC45A4 pAb (ATL-HPA023154) | |
Datasheet | Anti SLC45A4 pAb (ATL-HPA023154) Datasheet (External Link) |
Vendor Page | Anti SLC45A4 pAb (ATL-HPA023154) at Atlas |
Documents & Links for Anti SLC45A4 pAb (ATL-HPA023154) | |
Datasheet | Anti SLC45A4 pAb (ATL-HPA023154) Datasheet (External Link) |
Vendor Page | Anti SLC45A4 pAb (ATL-HPA023154) |