Anti SLC45A1 pAb (ATL-HPA078818)

Atlas Antibodies

Catalog No: ATL-HPA078818-25

• 

Product Description

Protein Description: solute carrier family 45 member 1
Gene Name: SLC45A1
Alternative Gene Name: DNB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039838: 86%, ENSRNOG00000018229: 86%
Entrez Gene ID: 50651
Uniprot ID: Q9Y2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG
• Gene Sequence: QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG
• Gene ID - Mouse: ENSMUSG00000039838
• Gene ID - Rat: ENSRNOG00000018229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.