Protein Description: solute carrier family 45 member 1
Gene Name: SLC45A1
Alternative Gene Name: DNB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039838: 86%, ENSRNOG00000018229: 86%
Entrez Gene ID: 50651
Uniprot ID: Q9Y2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC45A1
Alternative Gene Name: DNB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039838: 86%, ENSRNOG00000018229: 86%
Entrez Gene ID: 50651
Uniprot ID: Q9Y2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG |
| Documents & Links for Anti SLC45A1 pAb (ATL-HPA078818) | |
| Datasheet | Anti SLC45A1 pAb (ATL-HPA078818) Datasheet (External Link) |
| Vendor Page | Anti SLC45A1 pAb (ATL-HPA078818) at Atlas |
| Documents & Links for Anti SLC45A1 pAb (ATL-HPA078818) | |
| Datasheet | Anti SLC45A1 pAb (ATL-HPA078818) Datasheet (External Link) |
| Vendor Page | Anti SLC45A1 pAb (ATL-HPA078818) |