Protein Description: solute carrier family 44 member 1
Gene Name: SLC44A1
Alternative Gene Name: CD92, CDw92, CHTL1, CTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028412: 95%, ENSRNOG00000055089: 95%
Entrez Gene ID: 23446
Uniprot ID: Q8WWI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC44A1
Alternative Gene Name: CD92, CDw92, CHTL1, CTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028412: 95%, ENSRNOG00000055089: 95%
Entrez Gene ID: 23446
Uniprot ID: Q8WWI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS |
| Documents & Links for Anti SLC44A1 pAb (ATL-HPA074007) | |
| Datasheet | Anti SLC44A1 pAb (ATL-HPA074007) Datasheet (External Link) |
| Vendor Page | Anti SLC44A1 pAb (ATL-HPA074007) at Atlas |
| Documents & Links for Anti SLC44A1 pAb (ATL-HPA074007) | |
| Datasheet | Anti SLC44A1 pAb (ATL-HPA074007) Datasheet (External Link) |
| Vendor Page | Anti SLC44A1 pAb (ATL-HPA074007) |