Protein Description: solute carrier family 43 member 3
Gene Name: SLC43A3
Alternative Gene Name: DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027074: 51%, ENSRNOG00000061768: 54%
Entrez Gene ID: 29015
Uniprot ID: Q8NBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC43A3
Alternative Gene Name: DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027074: 51%, ENSRNOG00000061768: 54%
Entrez Gene ID: 29015
Uniprot ID: Q8NBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFS |
Documents & Links for Anti SLC43A3 pAb (ATL-HPA077244) | |
Datasheet | Anti SLC43A3 pAb (ATL-HPA077244) Datasheet (External Link) |
Vendor Page | Anti SLC43A3 pAb (ATL-HPA077244) at Atlas |
Documents & Links for Anti SLC43A3 pAb (ATL-HPA077244) | |
Datasheet | Anti SLC43A3 pAb (ATL-HPA077244) Datasheet (External Link) |
Vendor Page | Anti SLC43A3 pAb (ATL-HPA077244) |