Protein Description: solute carrier family 3 member 1
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN |
| Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102) | |
| Datasheet | Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link) |
| Vendor Page | Anti SLC3A1 pAb (ATL-HPA071102) at Atlas |
| Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102) | |
| Datasheet | Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link) |
| Vendor Page | Anti SLC3A1 pAb (ATL-HPA071102) |