Description
Product Description
Protein Description: solute carrier family 3 member 1
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN |
Gene Sequence | SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN |
Gene ID - Mouse | ENSMUSG00000024131 |
Gene ID - Rat | ENSRNOG00000007006 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102) | |
Datasheet | Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link) |
Vendor Page | Anti SLC3A1 pAb (ATL-HPA071102) at Atlas Antibodies |
Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102) | |
Datasheet | Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link) |
Vendor Page | Anti SLC3A1 pAb (ATL-HPA071102) |