Anti SLC3A1 pAb (ATL-HPA071102)

Atlas Antibodies

Catalog No: ATL-HPA071102-100

• 
• 

Product Description

Protein Description: solute carrier family 3 member 1
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
• Gene Sequence: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
• Gene ID - Mouse: ENSMUSG00000024131
• Gene ID - Rat: ENSRNOG00000007006
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.