Description
Product Description
Protein Description: solute carrier family 39, member 9
Gene Name: SLC39A9
Alternative Gene Name: FLJ11274
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048833: 84%, ENSRNOG00000005052: 89%
Entrez Gene ID: 55334
Uniprot ID: Q9NUM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC39A9
Alternative Gene Name: FLJ11274
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048833: 84%, ENSRNOG00000005052: 89%
Entrez Gene ID: 55334
Uniprot ID: Q9NUM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI |
Gene Sequence | VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI |
Gene ID - Mouse | ENSMUSG00000048833 |
Gene ID - Rat | ENSRNOG00000005052 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC39A9 pAb (ATL-HPA075390) | |
Datasheet | Anti SLC39A9 pAb (ATL-HPA075390) Datasheet (External Link) |
Vendor Page | Anti SLC39A9 pAb (ATL-HPA075390) at Atlas Antibodies |
Documents & Links for Anti SLC39A9 pAb (ATL-HPA075390) | |
Datasheet | Anti SLC39A9 pAb (ATL-HPA075390) Datasheet (External Link) |
Vendor Page | Anti SLC39A9 pAb (ATL-HPA075390) |