Protein Description: solute carrier family 39, member 9
Gene Name: SLC39A9
Alternative Gene Name: FLJ11274
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048833: 84%, ENSRNOG00000005052: 89%
Entrez Gene ID: 55334
Uniprot ID: Q9NUM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC39A9
Alternative Gene Name: FLJ11274
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048833: 84%, ENSRNOG00000005052: 89%
Entrez Gene ID: 55334
Uniprot ID: Q9NUM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI |
| Documents & Links for Anti SLC39A9 pAb (ATL-HPA075390) | |
| Datasheet | Anti SLC39A9 pAb (ATL-HPA075390) Datasheet (External Link) |
| Vendor Page | Anti SLC39A9 pAb (ATL-HPA075390) at Atlas |
| Documents & Links for Anti SLC39A9 pAb (ATL-HPA075390) | |
| Datasheet | Anti SLC39A9 pAb (ATL-HPA075390) Datasheet (External Link) |
| Vendor Page | Anti SLC39A9 pAb (ATL-HPA075390) |