Protein Description: solute carrier family 39 member 2
Gene Name: SLC39A2
Alternative Gene Name: ZIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072572: 66%, ENSRNOG00000010375: 66%
Entrez Gene ID: 29986
Uniprot ID: Q9NP94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC39A2
Alternative Gene Name: ZIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072572: 66%, ENSRNOG00000010375: 66%
Entrez Gene ID: 29986
Uniprot ID: Q9NP94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY |
| Documents & Links for Anti SLC39A2 pAb (ATL-HPA073231) | |
| Datasheet | Anti SLC39A2 pAb (ATL-HPA073231) Datasheet (External Link) |
| Vendor Page | Anti SLC39A2 pAb (ATL-HPA073231) at Atlas |
| Documents & Links for Anti SLC39A2 pAb (ATL-HPA073231) | |
| Datasheet | Anti SLC39A2 pAb (ATL-HPA073231) Datasheet (External Link) |
| Vendor Page | Anti SLC39A2 pAb (ATL-HPA073231) |