Protein Description: solute carrier family 38, member 10
Gene Name: SLC38A10
Alternative Gene Name: MGC15523, PP1744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039852: 31%, ENSRNOG00000017940: 31%
Entrez Gene ID: 124565
Uniprot ID: Q9HBR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC38A10
Alternative Gene Name: MGC15523, PP1744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039852: 31%, ENSRNOG00000017940: 31%
Entrez Gene ID: 124565
Uniprot ID: Q9HBR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA |
| Gene Sequence | MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA |
| Gene ID - Mouse | ENSMUSG00000039852 |
| Gene ID - Rat | ENSRNOG00000017940 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) | |
| Datasheet | Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) | |
| Datasheet | Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC38A10 pAb (ATL-HPA023161 w/enhanced validation) |