Description
Product Description
Protein Description: solute carrier family 35 member F2
Gene Name: SLC35F2
Alternative Gene Name: FLJ13018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042195: 55%, ENSRNOG00000009014: 55%
Entrez Gene ID: 54733
Uniprot ID: Q8IXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC35F2
Alternative Gene Name: FLJ13018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042195: 55%, ENSRNOG00000009014: 55%
Entrez Gene ID: 54733
Uniprot ID: Q8IXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN |
Gene Sequence | MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN |
Gene ID - Mouse | ENSMUSG00000042195 |
Gene ID - Rat | ENSRNOG00000009014 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) | |
Datasheet | Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) | |
Datasheet | Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC35F2 pAb (ATL-HPA060150 w/enhanced validation) |