Description
Product Description
Protein Description: solute carrier family 35, member E2
Gene Name: SLC35E2
Alternative Gene Name: KIAA0447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070319: 34%, ENSRNOG00000010457: 34%
Entrez Gene ID: 9906
Uniprot ID: P0CK97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC35E2
Alternative Gene Name: KIAA0447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070319: 34%, ENSRNOG00000010457: 34%
Entrez Gene ID: 9906
Uniprot ID: P0CK97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP |
| Gene Sequence | LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP |
| Gene ID - Mouse | ENSMUSG00000070319 |
| Gene ID - Rat | ENSRNOG00000010457 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711) | |
| Datasheet | Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link) |
| Vendor Page | Anti SLC35E2 pAb (ATL-HPA062711) at Atlas Antibodies |
| Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711) | |
| Datasheet | Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link) |
| Vendor Page | Anti SLC35E2 pAb (ATL-HPA062711) |