Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation)

Catalog No:
ATL-HPA058859-25
$303.00

Description

Product Description

Protein Description: solute carrier family 32 member 1
Gene Name: SLC32A1
Alternative Gene Name: SLC32A1, bA122O1.1, VIAAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037771: 95%, ENSRNOG00000015393: 93%
Entrez Gene ID: 140679
Uniprot ID: Q9H598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Gene Sequence ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Gene ID - Mouse ENSMUSG00000037771
Gene ID - Rat ENSRNOG00000015393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation)
Datasheet Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation)

Citations

Citations for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) – 1 Found
Gomez-Giro, Gemma; Arias-Fuenzalida, Jonathan; Jarazo, Javier; Zeuschner, Dagmar; Ali, Muhammad; Possemis, Nina; Bolognin, Silvia; Halder, Rashi; Jäger, Christian; Kuper, Willemijn F E; van Hasselt, Peter M; Zaehres, Holm; Del Sol, Antonio; van der Putten, Herman; Schöler, Hans R; Schwamborn, Jens C. Synapse alterations precede neuronal damage and storage pathology in a human cerebral organoid model of CLN3-juvenile neuronal ceroid lipofuscinosis. Acta Neuropathologica Communications. 2019;7(1):222.  PubMed

Product Description

Protein Description: solute carrier family 32 member 1
Gene Name: SLC32A1
Alternative Gene Name: SLC32A1, bA122O1.1, VIAAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037771: 95%, ENSRNOG00000015393: 93%
Entrez Gene ID: 140679
Uniprot ID: Q9H598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Gene Sequence ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Gene ID - Mouse ENSMUSG00000037771
Gene ID - Rat ENSRNOG00000015393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation)
Datasheet Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation)

Citations

Citations for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) – 1 Found
Gomez-Giro, Gemma; Arias-Fuenzalida, Jonathan; Jarazo, Javier; Zeuschner, Dagmar; Ali, Muhammad; Possemis, Nina; Bolognin, Silvia; Halder, Rashi; Jäger, Christian; Kuper, Willemijn F E; van Hasselt, Peter M; Zaehres, Holm; Del Sol, Antonio; van der Putten, Herman; Schöler, Hans R; Schwamborn, Jens C. Synapse alterations precede neuronal damage and storage pathology in a human cerebral organoid model of CLN3-juvenile neuronal ceroid lipofuscinosis. Acta Neuropathologica Communications. 2019;7(1):222.  PubMed