Description
Product Description
Protein Description: solute carrier family 32 member 1
Gene Name: SLC32A1
Alternative Gene Name: SLC32A1, bA122O1.1, VIAAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037771: 95%, ENSRNOG00000015393: 93%
Entrez Gene ID: 140679
Uniprot ID: Q9H598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC32A1
Alternative Gene Name: SLC32A1, bA122O1.1, VIAAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037771: 95%, ENSRNOG00000015393: 93%
Entrez Gene ID: 140679
Uniprot ID: Q9H598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
Gene Sequence | ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
Gene ID - Mouse | ENSMUSG00000037771 |
Gene ID - Rat | ENSRNOG00000015393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) | |
Datasheet | Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) | |
Datasheet | Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) |
Citations
Citations for Anti SLC32A1 pAb (ATL-HPA058859 w/enhanced validation) – 1 Found |
Gomez-Giro, Gemma; Arias-Fuenzalida, Jonathan; Jarazo, Javier; Zeuschner, Dagmar; Ali, Muhammad; Possemis, Nina; Bolognin, Silvia; Halder, Rashi; Jäger, Christian; Kuper, Willemijn F E; van Hasselt, Peter M; Zaehres, Holm; Del Sol, Antonio; van der Putten, Herman; Schöler, Hans R; Schwamborn, Jens C. Synapse alterations precede neuronal damage and storage pathology in a human cerebral organoid model of CLN3-juvenile neuronal ceroid lipofuscinosis. Acta Neuropathologica Communications. 2019;7(1):222. PubMed |