Anti SLC30A8 pAb (ATL-HPA076165 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA076165-25

• 

Product Description

Protein Description: solute carrier family 30 member 8
Gene Name: SLC30A8
Alternative Gene Name: ZnT-8, ZNT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022315: 73%, ENSRNOG00000004747: 73%
Entrez Gene ID: 169026
Uniprot ID: Q8IWU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
• Gene Sequence: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
• Gene ID - Mouse: ENSMUSG00000022315
• Gene ID - Rat: ENSRNOG00000004747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.