Anti SLC30A6 pAb (ATL-HPA057328)

Atlas Antibodies

Catalog No: ATL-HPA057328-25

• 
• 
• 

Product Description

Protein Description: solute carrier family 30 (zinc transporter), member 6
Gene Name: SLC30A6
Alternative Gene Name: FLJ31101, ZNT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024069: 73%, ENSRNOG00000005856: 76%
Entrez Gene ID: 55676
Uniprot ID: Q6NXT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
• Gene Sequence: NVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
• Gene ID - Mouse: ENSMUSG00000024069
• Gene ID - Rat: ENSRNOG00000005856
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.