Protein Description: solute carrier family 30 (zinc transporter), member 3
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL |
| Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637) | |
| Datasheet | Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link) |
| Vendor Page | Anti SLC30A3 pAb (ATL-HPA067637) at Atlas |
| Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637) | |
| Datasheet | Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link) |
| Vendor Page | Anti SLC30A3 pAb (ATL-HPA067637) |