Description
Product Description
Protein Description: solute carrier family 30 (zinc transporter), member 3
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL |
Gene Sequence | GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL |
Gene ID - Mouse | ENSMUSG00000029151 |
Gene ID - Rat | ENSRNOG00000006204 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637) | |
Datasheet | Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link) |
Vendor Page | Anti SLC30A3 pAb (ATL-HPA067637) at Atlas Antibodies |
Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637) | |
Datasheet | Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link) |
Vendor Page | Anti SLC30A3 pAb (ATL-HPA067637) |