Description
Product Description
Protein Description: solute carrier family 30 member 10
Gene Name: SLC30A10
Alternative Gene Name: DKFZp547M236, ZnT-10, ZNT8, ZRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026614: 75%, ENSRNOG00000002397: 80%
Entrez Gene ID: 55532
Uniprot ID: Q6XR72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC30A10
Alternative Gene Name: DKFZp547M236, ZnT-10, ZNT8, ZRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026614: 75%, ENSRNOG00000002397: 80%
Entrez Gene ID: 55532
Uniprot ID: Q6XR72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL |
Gene Sequence | SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL |
Gene ID - Mouse | ENSMUSG00000026614 |
Gene ID - Rat | ENSRNOG00000002397 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC30A10 pAb (ATL-HPA064547) | |
Datasheet | Anti SLC30A10 pAb (ATL-HPA064547) Datasheet (External Link) |
Vendor Page | Anti SLC30A10 pAb (ATL-HPA064547) at Atlas Antibodies |
Documents & Links for Anti SLC30A10 pAb (ATL-HPA064547) | |
Datasheet | Anti SLC30A10 pAb (ATL-HPA064547) Datasheet (External Link) |
Vendor Page | Anti SLC30A10 pAb (ATL-HPA064547) |