Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation)

Catalog No:
ATL-HPA075669-25
$395.00

Description

Product Description

Protein Description: solute carrier family 2 member 9
Gene Name: SLC2A9
Alternative Gene Name: Glut9, GLUTX, URATv1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005107: 68%, ENSRNOG00000005302: 68%
Entrez Gene ID: 56606
Uniprot ID: Q9NRM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Gene Sequence NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Gene ID - Mouse ENSMUSG00000005107
Gene ID - Rat ENSRNOG00000005302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation)
Datasheet Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation)

Product Description

Protein Description: solute carrier family 2 member 9
Gene Name: SLC2A9
Alternative Gene Name: Glut9, GLUTX, URATv1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005107: 68%, ENSRNOG00000005302: 68%
Entrez Gene ID: 56606
Uniprot ID: Q9NRM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Gene Sequence NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Gene ID - Mouse ENSMUSG00000005107
Gene ID - Rat ENSRNOG00000005302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation)
Datasheet Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation)