Description
Product Description
Protein Description: solute carrier family 2 member 9
Gene Name: SLC2A9
Alternative Gene Name: Glut9, GLUTX, URATv1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005107: 68%, ENSRNOG00000005302: 68%
Entrez Gene ID: 56606
Uniprot ID: Q9NRM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC2A9
Alternative Gene Name: Glut9, GLUTX, URATv1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005107: 68%, ENSRNOG00000005302: 68%
Entrez Gene ID: 56606
Uniprot ID: Q9NRM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP |
Gene Sequence | NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP |
Gene ID - Mouse | ENSMUSG00000005107 |
Gene ID - Rat | ENSRNOG00000005302 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) | |
Datasheet | Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) | |
Datasheet | Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC2A9 pAb (ATL-HPA075669 w/enhanced validation) |