Description
Product Description
Protein Description: SLC2A4 regulator
Gene Name: SLC2A4RG
Alternative Gene Name: GEF, HDBP1, Si-1-2, Si-1-2-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032657: 29%, ENSRNOG00000056817: 33%
Entrez Gene ID: 56731
Uniprot ID: Q9NR83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC2A4RG
Alternative Gene Name: GEF, HDBP1, Si-1-2, Si-1-2-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032657: 29%, ENSRNOG00000056817: 33%
Entrez Gene ID: 56731
Uniprot ID: Q9NR83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP |
| Gene Sequence | PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP |
| Gene ID - Mouse | ENSMUSG00000032657 |
| Gene ID - Rat | ENSRNOG00000056817 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SLC2A4RG pAb (ATL-HPA063050) | |
| Datasheet | Anti SLC2A4RG pAb (ATL-HPA063050) Datasheet (External Link) |
| Vendor Page | Anti SLC2A4RG pAb (ATL-HPA063050) at Atlas Antibodies |
| Documents & Links for Anti SLC2A4RG pAb (ATL-HPA063050) | |
| Datasheet | Anti SLC2A4RG pAb (ATL-HPA063050) Datasheet (External Link) |
| Vendor Page | Anti SLC2A4RG pAb (ATL-HPA063050) |