Protein Description: solute carrier family 2 (facilitated glucose transporter), member 11
Gene Name: SLC2A11
Alternative Gene Name: GLUT10, GLUT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031641: 43%, ENSRNOG00000024411: 40%
Entrez Gene ID: 66035
Uniprot ID: Q9BYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC2A11
Alternative Gene Name: GLUT10, GLUT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031641: 43%, ENSRNOG00000024411: 40%
Entrez Gene ID: 66035
Uniprot ID: Q9BYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL |
Documents & Links for Anti SLC2A11 pAb (ATL-HPA071184) | |
Datasheet | Anti SLC2A11 pAb (ATL-HPA071184) Datasheet (External Link) |
Vendor Page | Anti SLC2A11 pAb (ATL-HPA071184) at Atlas |
Documents & Links for Anti SLC2A11 pAb (ATL-HPA071184) | |
Datasheet | Anti SLC2A11 pAb (ATL-HPA071184) Datasheet (External Link) |
Vendor Page | Anti SLC2A11 pAb (ATL-HPA071184) |