Description
Product Description
Protein Description: solute carrier family 29 (equilibrative nucleoside transporter), member 3
Gene Name: SLC29A3
Alternative Gene Name: ENT3, FLJ11160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020100: 80%, ENSRNOG00000000568: 80%
Entrez Gene ID: 55315
Uniprot ID: Q9BZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC29A3
Alternative Gene Name: ENT3, FLJ11160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020100: 80%, ENSRNOG00000000568: 80%
Entrez Gene ID: 55315
Uniprot ID: Q9BZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEYWMFKLRNSSSPATGEDPEGSDILNYFE |
| Gene Sequence | KEYWMFKLRNSSSPATGEDPEGSDILNYFE |
| Gene ID - Mouse | ENSMUSG00000020100 |
| Gene ID - Rat | ENSRNOG00000000568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SLC29A3 pAb (ATL-HPA057905) | |
| Datasheet | Anti SLC29A3 pAb (ATL-HPA057905) Datasheet (External Link) |
| Vendor Page | Anti SLC29A3 pAb (ATL-HPA057905) at Atlas Antibodies |
| Documents & Links for Anti SLC29A3 pAb (ATL-HPA057905) | |
| Datasheet | Anti SLC29A3 pAb (ATL-HPA057905) Datasheet (External Link) |
| Vendor Page | Anti SLC29A3 pAb (ATL-HPA057905) |