Anti SLC27A3 pAb (ATL-HPA067508)

Atlas Antibodies

Catalog No: ATL-HPA067508-25

• 

Product Description

Protein Description: solute carrier family 27 (fatty acid transporter), member 3
Gene Name: SLC27A3
Alternative Gene Name: ACSVL3, FATP3, MGC4365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027932: 88%, ENSRNOG00000015421: 89%
Entrez Gene ID: 11000
Uniprot ID: Q5K4L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR
• Gene Sequence: DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR
• Gene ID - Mouse: ENSMUSG00000027932
• Gene ID - Rat: ENSRNOG00000015421
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.