Protein Description: solute carrier family 27 (fatty acid transporter), member 3
Gene Name: SLC27A3
Alternative Gene Name: ACSVL3, FATP3, MGC4365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027932: 88%, ENSRNOG00000015421: 89%
Entrez Gene ID: 11000
Uniprot ID: Q5K4L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC27A3
Alternative Gene Name: ACSVL3, FATP3, MGC4365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027932: 88%, ENSRNOG00000015421: 89%
Entrez Gene ID: 11000
Uniprot ID: Q5K4L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR |
Documents & Links for Anti SLC27A3 pAb (ATL-HPA067508) | |
Datasheet | Anti SLC27A3 pAb (ATL-HPA067508) Datasheet (External Link) |
Vendor Page | Anti SLC27A3 pAb (ATL-HPA067508) at Atlas |
Documents & Links for Anti SLC27A3 pAb (ATL-HPA067508) | |
Datasheet | Anti SLC27A3 pAb (ATL-HPA067508) Datasheet (External Link) |
Vendor Page | Anti SLC27A3 pAb (ATL-HPA067508) |