Protein Description: solute carrier family 27 member 1
Gene Name: SLC27A1
Alternative Gene Name: ACSVL5, FATP, FATP1, FLJ00336, MGC71751
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031808: 80%, ENSRNOG00000018170: 83%
Entrez Gene ID: 376497
Uniprot ID: Q6PCB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC27A1
Alternative Gene Name: ACSVL5, FATP, FATP1, FLJ00336, MGC71751
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031808: 80%, ENSRNOG00000018170: 83%
Entrez Gene ID: 376497
Uniprot ID: Q6PCB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF |
Documents & Links for Anti SLC27A1 pAb (ATL-HPA076520) | |
Datasheet | Anti SLC27A1 pAb (ATL-HPA076520) Datasheet (External Link) |
Vendor Page | Anti SLC27A1 pAb (ATL-HPA076520) at Atlas |
Documents & Links for Anti SLC27A1 pAb (ATL-HPA076520) | |
Datasheet | Anti SLC27A1 pAb (ATL-HPA076520) Datasheet (External Link) |
Vendor Page | Anti SLC27A1 pAb (ATL-HPA076520) |