Description
Product Description
Protein Description: solute carrier family 26 (anion exchanger), member 2
Gene Name: SLC26A2
Alternative Gene Name: DTD, DTDST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034320: 52%, ENSRNOG00000018082: 51%
Entrez Gene ID: 1836
Uniprot ID: P50443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC26A2
Alternative Gene Name: DTD, DTDST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034320: 52%, ENSRNOG00000018082: 51%
Entrez Gene ID: 1836
Uniprot ID: P50443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP |
Gene Sequence | ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP |
Gene ID - Mouse | ENSMUSG00000034320 |
Gene ID - Rat | ENSRNOG00000018082 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) | |
Datasheet | Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) | |
Datasheet | Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) |