Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation)

Catalog No:
ATL-HPA058090-25
$303.00

Description

Product Description

Protein Description: solute carrier family 26 (anion exchanger), member 2
Gene Name: SLC26A2
Alternative Gene Name: DTD, DTDST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034320: 52%, ENSRNOG00000018082: 51%
Entrez Gene ID: 1836
Uniprot ID: P50443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP
Gene Sequence ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP
Gene ID - Mouse ENSMUSG00000034320
Gene ID - Rat ENSRNOG00000018082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation)
Datasheet Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation)

Product Description

Protein Description: solute carrier family 26 (anion exchanger), member 2
Gene Name: SLC26A2
Alternative Gene Name: DTD, DTDST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034320: 52%, ENSRNOG00000018082: 51%
Entrez Gene ID: 1836
Uniprot ID: P50443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP
Gene Sequence ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP
Gene ID - Mouse ENSMUSG00000034320
Gene ID - Rat ENSRNOG00000018082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation)
Datasheet Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC26A2 pAb (ATL-HPA058090 w/enhanced validation)