Anti SLC25A51 pAb (ATL-HPA058261)

Atlas Antibodies

Catalog No: ATL-HPA058261-25

• 

Product Description

Protein Description: solute carrier family 25, member 51
Gene Name: SLC25A51
Alternative Gene Name: CG7943, MCART1, MGC14836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045973: 83%, ENSRNOG00000039278: 69%
Entrez Gene ID: 92014
Uniprot ID: Q9H1U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLC
• Gene Sequence: MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLC
• Gene ID - Mouse: ENSMUSG00000045973
• Gene ID - Rat: ENSRNOG00000039278
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.