Protein Description: solute carrier family 25, member 46
Gene Name: SLC25A46
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024259: 97%, ENSRNOG00000017091: 95%
Entrez Gene ID: 91137
Uniprot ID: Q96AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A46
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024259: 97%, ENSRNOG00000017091: 95%
Entrez Gene ID: 91137
Uniprot ID: Q96AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI |
| Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582) | |
| Datasheet | Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link) |
| Vendor Page | Anti SLC25A46 pAb (ATL-HPA071582) at Atlas |
| Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582) | |
| Datasheet | Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link) |
| Vendor Page | Anti SLC25A46 pAb (ATL-HPA071582) |