Description
Product Description
Protein Description: solute carrier family 25, member 46
Gene Name: SLC25A46
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024259: 97%, ENSRNOG00000017091: 95%
Entrez Gene ID: 91137
Uniprot ID: Q96AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A46
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024259: 97%, ENSRNOG00000017091: 95%
Entrez Gene ID: 91137
Uniprot ID: Q96AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI |
Gene Sequence | LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI |
Gene ID - Mouse | ENSMUSG00000024259 |
Gene ID - Rat | ENSRNOG00000017091 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582) | |
Datasheet | Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link) |
Vendor Page | Anti SLC25A46 pAb (ATL-HPA071582) at Atlas Antibodies |
Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582) | |
Datasheet | Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link) |
Vendor Page | Anti SLC25A46 pAb (ATL-HPA071582) |