Protein Description: solute carrier family 25, member 44
Gene Name: SLC25A44
Alternative Gene Name: FLJ90431, KIAA0446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050144: 92%, ENSRNOG00000025269: 92%
Entrez Gene ID: 9673
Uniprot ID: Q96H78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A44
Alternative Gene Name: FLJ90431, KIAA0446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050144: 92%, ENSRNOG00000025269: 92%
Entrez Gene ID: 9673
Uniprot ID: Q96H78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGF |
Documents & Links for Anti SLC25A44 pAb (ATL-HPA065411) | |
Datasheet | Anti SLC25A44 pAb (ATL-HPA065411) Datasheet (External Link) |
Vendor Page | Anti SLC25A44 pAb (ATL-HPA065411) at Atlas |
Documents & Links for Anti SLC25A44 pAb (ATL-HPA065411) | |
Datasheet | Anti SLC25A44 pAb (ATL-HPA065411) Datasheet (External Link) |
Vendor Page | Anti SLC25A44 pAb (ATL-HPA065411) |