Protein Description: solute carrier family 25 member 43
Gene Name: SLC25A43
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037636: 91%, ENSRNOG00000012756: 85%
Entrez Gene ID: 203427
Uniprot ID: Q8WUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A43
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037636: 91%, ENSRNOG00000012756: 85%
Entrez Gene ID: 203427
Uniprot ID: Q8WUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NGYILSPLSYKLTPGVDQSLQPQELRELKKFFK |
| Gene ID - Mouse | ENSMUSG00000037636 |
| Gene ID - Rat | ENSMUSG00000037636 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A43 pAb (ATL-HPA078530) | |
| Datasheet | Anti SLC25A43 pAb (ATL-HPA078530) Datasheet (External Link) |
| Vendor Page | Anti SLC25A43 pAb (ATL-HPA078530) at Atlas |
| Documents & Links for Anti SLC25A43 pAb (ATL-HPA078530) | |
| Datasheet | Anti SLC25A43 pAb (ATL-HPA078530) Datasheet (External Link) |
| Vendor Page | Anti SLC25A43 pAb (ATL-HPA078530) |