Anti SLC25A37 pAb (ATL-HPA045680)

Catalog No:
ATL-HPA045680-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: solute carrier family 25 (mitochondrial iron transporter), member 37
Gene Name: SLC25A37
Alternative Gene Name: MFRN, MFRN1, MSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034248: 78%, ENSRNOG00000015495: 78%
Entrez Gene ID: 51312
Uniprot ID: Q9NYZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Gene Sequence ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Gene ID - Mouse ENSMUSG00000034248
Gene ID - Rat ENSRNOG00000015495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC25A37 pAb (ATL-HPA045680)
Datasheet Anti SLC25A37 pAb (ATL-HPA045680) Datasheet (External Link)
Vendor Page Anti SLC25A37 pAb (ATL-HPA045680) at Atlas Antibodies

Documents & Links for Anti SLC25A37 pAb (ATL-HPA045680)
Datasheet Anti SLC25A37 pAb (ATL-HPA045680) Datasheet (External Link)
Vendor Page Anti SLC25A37 pAb (ATL-HPA045680)