Protein Description: solute carrier family 25 (mitochondrial iron transporter), member 37
Gene Name: SLC25A37
Alternative Gene Name: MFRN, MFRN1, MSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034248: 78%, ENSRNOG00000015495: 78%
Entrez Gene ID: 51312
Uniprot ID: Q9NYZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A37
Alternative Gene Name: MFRN, MFRN1, MSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034248: 78%, ENSRNOG00000015495: 78%
Entrez Gene ID: 51312
Uniprot ID: Q9NYZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ARRMDGDSRDGGGGKDATGSEDYENLPTSASV |
Documents & Links for Anti SLC25A37 pAb (ATL-HPA045680) | |
Datasheet | Anti SLC25A37 pAb (ATL-HPA045680) Datasheet (External Link) |
Vendor Page | Anti SLC25A37 pAb (ATL-HPA045680) at Atlas |
Documents & Links for Anti SLC25A37 pAb (ATL-HPA045680) | |
Datasheet | Anti SLC25A37 pAb (ATL-HPA045680) Datasheet (External Link) |
Vendor Page | Anti SLC25A37 pAb (ATL-HPA045680) |