Protein Description: solute carrier family 25, member 34
Gene Name: SLC25A34
Alternative Gene Name: DKFZp781A10161
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040740: 85%, ENSRNOG00000021526: 87%
Entrez Gene ID: 284723
Uniprot ID: Q6PIV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A34
Alternative Gene Name: DKFZp781A10161
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040740: 85%, ENSRNOG00000021526: 87%
Entrez Gene ID: 284723
Uniprot ID: Q6PIV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG |
Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806) | |
Datasheet | Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link) |
Vendor Page | Anti SLC25A34 pAb (ATL-HPA069806) at Atlas |
Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806) | |
Datasheet | Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link) |
Vendor Page | Anti SLC25A34 pAb (ATL-HPA069806) |