Anti SLC25A34 pAb (ATL-HPA069806)

Catalog No:
ATL-HPA069806-25
$447.00

Description

Product Description

Protein Description: solute carrier family 25, member 34
Gene Name: SLC25A34
Alternative Gene Name: DKFZp781A10161
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040740: 85%, ENSRNOG00000021526: 87%
Entrez Gene ID: 284723
Uniprot ID: Q6PIV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Gene Sequence PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Gene ID - Mouse ENSMUSG00000040740
Gene ID - Rat ENSRNOG00000021526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806)
Datasheet Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link)
Vendor Page Anti SLC25A34 pAb (ATL-HPA069806) at Atlas Antibodies

Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806)
Datasheet Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link)
Vendor Page Anti SLC25A34 pAb (ATL-HPA069806)

Product Description

Protein Description: solute carrier family 25, member 34
Gene Name: SLC25A34
Alternative Gene Name: DKFZp781A10161
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040740: 85%, ENSRNOG00000021526: 87%
Entrez Gene ID: 284723
Uniprot ID: Q6PIV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Gene Sequence PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Gene ID - Mouse ENSMUSG00000040740
Gene ID - Rat ENSRNOG00000021526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806)
Datasheet Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link)
Vendor Page Anti SLC25A34 pAb (ATL-HPA069806) at Atlas Antibodies

Documents & Links for Anti SLC25A34 pAb (ATL-HPA069806)
Datasheet Anti SLC25A34 pAb (ATL-HPA069806) Datasheet (External Link)
Vendor Page Anti SLC25A34 pAb (ATL-HPA069806)