Description
Product Description
Protein Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 91%, ENSRNOG00000020470: 89%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 91%, ENSRNOG00000020470: 89%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL |
Gene Sequence | MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL |
Gene ID - Mouse | ENSMUSG00000040322 |
Gene ID - Rat | ENSRNOG00000020470 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) | |
Datasheet | Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) | |
Datasheet | Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) |