Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation)

Catalog No:
ATL-HPA063636-25
$303.00

Description

Product Description

Protein Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 91%, ENSRNOG00000020470: 89%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
Gene Sequence MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
Gene ID - Mouse ENSMUSG00000040322
Gene ID - Rat ENSRNOG00000020470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation)
Datasheet Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation)

Product Description

Protein Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 91%, ENSRNOG00000020470: 89%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
Gene Sequence MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
Gene ID - Mouse ENSMUSG00000040322
Gene ID - Rat ENSRNOG00000020470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation)
Datasheet Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC25A24 pAb (ATL-HPA063636 w/enhanced validation)