Protein Description: solute carrier family 22 member 6
Gene Name: SLC22A6
Alternative Gene Name: OAT1, PAHT, ROAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024650: 41%, ENSRNOG00000018215: 47%
Entrez Gene ID: 9356
Uniprot ID: Q4U2R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC22A6
Alternative Gene Name: OAT1, PAHT, ROAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024650: 41%, ENSRNOG00000018215: 47%
Entrez Gene ID: 9356
Uniprot ID: Q4U2R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ |
| Documents & Links for Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) | |
| Datasheet | Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) | |
| Datasheet | Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) |