Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA074559-25

• 

Product Description

Protein Description: solute carrier family 22 member 6
Gene Name: SLC22A6
Alternative Gene Name: OAT1, PAHT, ROAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024650: 41%, ENSRNOG00000018215: 47%
Entrez Gene ID: 9356
Uniprot ID: Q4U2R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
• Gene Sequence: PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
• Gene ID - Mouse: ENSMUSG00000024650
• Gene ID - Rat: ENSRNOG00000018215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.