Protein Description: solute carrier family 22 (organic cation transporter), member 18 antisense
Gene Name: SLC22A18AS
Alternative Gene Name: BWR1B, BWSCR1B, ORCTL2S, p27-BWR1B, SLC22A1LS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 29%, ENSRNOG00000017540: 28%
Entrez Gene ID: 5003
Uniprot ID: Q8N1D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC22A18AS
Alternative Gene Name: BWR1B, BWSCR1B, ORCTL2S, p27-BWR1B, SLC22A1LS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 29%, ENSRNOG00000017540: 28%
Entrez Gene ID: 5003
Uniprot ID: Q8N1D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG |
Documents & Links for Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) | |
Datasheet | Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) at Atlas |
Documents & Links for Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) | |
Datasheet | Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) |