Protein Description: solute carrier family 22 (organic cation transporter), member 1
Gene Name: SLC22A1
Alternative Gene Name: OCT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023829: 74%, ENSRNOG00000016337: 78%
Entrez Gene ID: 6580
Uniprot ID: O15245
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC22A1
Alternative Gene Name: OCT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023829: 74%, ENSRNOG00000016337: 78%
Entrez Gene ID: 6580
Uniprot ID: O15245
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL |
| Documents & Links for Anti SLC22A1 pAb (ATL-HPA029846) | |
| Datasheet | Anti SLC22A1 pAb (ATL-HPA029846) Datasheet (External Link) |
| Vendor Page | Anti SLC22A1 pAb (ATL-HPA029846) at Atlas |
| Documents & Links for Anti SLC22A1 pAb (ATL-HPA029846) | |
| Datasheet | Anti SLC22A1 pAb (ATL-HPA029846) Datasheet (External Link) |
| Vendor Page | Anti SLC22A1 pAb (ATL-HPA029846) |