Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation)

Catalog No:
ATL-HPA037468-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: solute carrier family 1 (glial high affinity glutamate transporter), member 3
Gene Name: SLC1A3
Alternative Gene Name: EA6, EAAT1, GLAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005360: 93%, ENSRNOG00000016163: 93%
Entrez Gene ID: 6507
Uniprot ID: P43003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
Gene Sequence LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
Gene ID - Mouse ENSMUSG00000005360
Gene ID - Rat ENSRNOG00000016163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation)
Datasheet Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation) at Atlas

Documents & Links for Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation)
Datasheet Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation)