Protein Description: solute carrier family 1 member 2
Gene Name: SLC1A2
Alternative Gene Name: EAAT2, GLT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005089: 95%, ENSRNOG00000005479: 95%
Entrez Gene ID: 6506
Uniprot ID: P43004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC1A2
Alternative Gene Name: EAAT2, GLT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005089: 95%, ENSRNOG00000005479: 95%
Entrez Gene ID: 6506
Uniprot ID: P43004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
Gene Sequence | TKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
Gene ID - Mouse | ENSMUSG00000005089 |
Gene ID - Rat | ENSRNOG00000005479 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) | |
Datasheet | Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) | |
Datasheet | Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC1A2 pAb (ATL-HPA067499 w/enhanced validation) |