Protein Description: solute carrier family 1 (glial high affinity glutamate transporter), member 2
Gene Name: SLC1A2
Alternative Gene Name: EAAT2, GLT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005089: 87%, ENSRNOG00000014816: 48%
Entrez Gene ID: 6506
Uniprot ID: P43004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC1A2
Alternative Gene Name: EAAT2, GLT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005089: 87%, ENSRNOG00000014816: 48%
Entrez Gene ID: 6506
Uniprot ID: P43004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV |
Documents & Links for Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) | |
Datasheet | Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) at Atlas |
Documents & Links for Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) | |
Datasheet | Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) |