Protein Description: solute carrier family 18 member A2
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD |
| Documents & Links for Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) | |
| Datasheet | Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) | |
| Datasheet | Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) |