Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)

Catalog No:
ATL-HPA073224-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Description

Product Description

Protein Description: solute carrier family 18 member A2
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene Sequence MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene ID - Mouse ENSMUSG00000025094
Gene ID - Rat ENSRNOG00000008890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)
Datasheet Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)

Product Description

Protein Description: solute carrier family 18 member A2
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene Sequence MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene ID - Mouse ENSMUSG00000025094
Gene ID - Rat ENSRNOG00000008890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)
Datasheet Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)