Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)

Catalog No:
ATL-HPA063797-25
$395.00

Description

Product Description

Protein Description: solute carrier family 18 (vesicular monoamine transporter), member 1
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 69%, ENSRNOG00000011992: 69%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Gene Sequence KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Gene ID - Mouse ENSMUSG00000036330
Gene ID - Rat ENSRNOG00000011992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)
Datasheet Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)

Product Description

Protein Description: solute carrier family 18 (vesicular monoamine transporter), member 1
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 69%, ENSRNOG00000011992: 69%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Gene Sequence KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Gene ID - Mouse ENSMUSG00000036330
Gene ID - Rat ENSRNOG00000011992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)
Datasheet Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)