Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation)

Catalog No:
ATL-HPA063679-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: solute carrier family 17 member 7
Gene Name: SLC17A7
Alternative Gene Name: SLC17A7, BNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070570: 94%, ENSRNOG00000020650: 94%
Entrez Gene ID: 57030
Uniprot ID: Q9P2U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSISEEERKYIEDAIGESAKLMNPLTKFSTP
Gene Sequence PSISEEERKYIEDAIGESAKLMNPLTKFSTP
Gene ID - Mouse ENSMUSG00000070570
Gene ID - Rat ENSRNOG00000020650
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation)
Datasheet Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation)