Protein Description: solute carrier family 17 member 7
Gene Name: SLC17A7
Alternative Gene Name: SLC17A7, BNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070570: 94%, ENSRNOG00000020650: 94%
Entrez Gene ID: 57030
Uniprot ID: Q9P2U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC17A7
Alternative Gene Name: SLC17A7, BNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070570: 94%, ENSRNOG00000020650: 94%
Entrez Gene ID: 57030
Uniprot ID: Q9P2U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
Gene Sequence | PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
Gene ID - Mouse | ENSMUSG00000070570 |
Gene ID - Rat | ENSRNOG00000020650 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) | |
Datasheet | Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) | |
Datasheet | Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation) |