Protein Description: solute carrier family 16, member 2 (thyroid hormone transporter)
Gene Name: SLC16A2
Alternative Gene Name: AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033965: 93%, ENSRNOG00000002832: 90%
Entrez Gene ID: 6567
Uniprot ID: P36021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC16A2
Alternative Gene Name: AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033965: 93%, ENSRNOG00000002832: 90%
Entrez Gene ID: 6567
Uniprot ID: P36021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
| Documents & Links for Anti SLC16A2 pAb (ATL-HPA072719) | |
| Datasheet | Anti SLC16A2 pAb (ATL-HPA072719) Datasheet (External Link) |
| Vendor Page | Anti SLC16A2 pAb (ATL-HPA072719) at Atlas |
| Documents & Links for Anti SLC16A2 pAb (ATL-HPA072719) | |
| Datasheet | Anti SLC16A2 pAb (ATL-HPA072719) Datasheet (External Link) |
| Vendor Page | Anti SLC16A2 pAb (ATL-HPA072719) |
| Citations for Anti SLC16A2 pAb (ATL-HPA072719) – 1 Found |
| Shrestha, Pawan; Whelchel, Amy E; Nicholas, Sarah E; Liang, Wentao; Ma, Jian-Xing; Karamichos, Dimitrios. Monocarboxylate Transporters: Role and Regulation in Corneal Diabetes. Analytical Cellular Pathology (Amsterdam). 2022( 36340268):6718566. PubMed |