Anti SLC13A1 pAb (ATL-HPA062714)

Atlas Antibodies

Catalog No: ATL-HPA062714-25

• 

Product Description

Protein Description: solute carrier family 13 (sodium/sulfate symporter), member 1
Gene Name: SLC13A1
Alternative Gene Name: NAS1, NaSi-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029700: 71%, ENSRNOG00000008121: 67%
Entrez Gene ID: 6561
Uniprot ID: Q9BZW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNN
• Gene Sequence: QIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNN
• Gene ID - Mouse: ENSMUSG00000029700
• Gene ID - Rat: ENSRNOG00000008121
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.