Protein Description: solute carrier family 12 (potassium/chloride transporter), member 5
Gene Name: SLC12A5
Alternative Gene Name: KCC2, KIAA1176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017740: 96%, ENSRNOG00000018111: 81%
Entrez Gene ID: 57468
Uniprot ID: Q9H2X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC12A5
Alternative Gene Name: KCC2, KIAA1176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017740: 96%, ENSRNOG00000018111: 81%
Entrez Gene ID: 57468
Uniprot ID: Q9H2X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC |
| Documents & Links for Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) | |
| Datasheet | Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) | |
| Datasheet | Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) |