Protein Description: solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Gene Name: SLC12A2
Alternative Gene Name: BSC, BSC2, NKCC1, PPP1R141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024597: 97%, ENSRNOG00000015971: 98%
Entrez Gene ID: 6558
Uniprot ID: P55011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC12A2
Alternative Gene Name: BSC, BSC2, NKCC1, PPP1R141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024597: 97%, ENSRNOG00000015971: 98%
Entrez Gene ID: 6558
Uniprot ID: P55011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI |
| Documents & Links for Anti SLC12A2 pAb (ATL-HPA063697) | |
| Datasheet | Anti SLC12A2 pAb (ATL-HPA063697) Datasheet (External Link) |
| Vendor Page | Anti SLC12A2 pAb (ATL-HPA063697) at Atlas |
| Documents & Links for Anti SLC12A2 pAb (ATL-HPA063697) | |
| Datasheet | Anti SLC12A2 pAb (ATL-HPA063697) Datasheet (External Link) |
| Vendor Page | Anti SLC12A2 pAb (ATL-HPA063697) |